PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g011610.1
Common NameMTR_3g011610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 521aa    MW: 57543.5 Da    PI: 6.7371
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g011610.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.3e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Medtr3g011610.1 39 KGPWTSAEDAILVDYVRKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding48.12.6e-1592135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  Medtr3g011610.1  92 KGSFTADEEHLIAQLHSEMGNR-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.9983490IPR017930Myb domain
SuperFamilySSF466898.59E-3038133IPR009057Homeodomain-like
SMARTSM007172.0E-153888IPR001005SANT/Myb domain
PfamPF002499.1E-163986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-234093IPR009057Homeodomain-like
CDDcd001671.23E-114186No hitNo description
PROSITE profilePS5129417.31291141IPR017930Myb domain
SMARTSM007175.7E-1491139IPR001005SANT/Myb domain
PfamPF002491.4E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2494140IPR009057Homeodomain-like
CDDcd001674.12E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MSRVKNEIED DMLCNDQTRS RSNGEVNGGS VNGGVVLKKG PWTSAEDAIL VDYVRKHGEG  60
NWNAVQKHSG LSRCGKSCRL RWANHLRPNL KKGSFTADEE HLIAQLHSEM GNRWARMAAH  120
LPGRTDNEIK NYWNTRTKRR TRAGLPIYPP EVRLRAIKGS KHGQSTGGIN DGDRGHHDFL  180
PKNNYEMHDA IFDNLKENQG ILPITILPEN PDISANSIMR NSLDSPPYCN PLPSTMSFLG  240
SSGMNKNWFY PFYHVQDHSS DKTLQSFELH SPLDPGLPSH NSMYYRHSVS NGNSSTSKPT  300
SKAVKLELPS LQYPETGFGG WGGNFPPSPL NESVDVFNQS PLPHCAQESG CSSPNNSGTL  360
EAIIYQKKTL PNSNNNCSDK SSHSSTTTPV DGGESSALNM NETEWDDYAS PFGATSILNE  420
CHAVNTNTNS WDKLTAAQNF SGSNVKYEPV EQVSTPNSEN RSMSMLNITW PDVMLASDWH  480
EQCYGHEKNM TEASDNLTDY KHVAGGTYSS STGGRFMHMA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-29361401104C-Myb DNA-Binding Domain
1msf_C1e-29361401104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458881.10.0myb transcription factor
TrEMBLA0A072UV520.0A0A072UV52_MEDTR; Myb transcription factor
STRINGGLYMA04G15150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-97myb domain protein 65
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]